Sign In | Join Free | My qualitytoyschina.com
qualitytoyschina.com
Products
Search by Category
Home > Chemicals > Rubber Chemicals >

Does Cjc 1295 Work

does cjc 1295 work

All does cjc 1295 work wholesalers & does cjc 1295 work manufacturers come from members. We doesn't provide does cjc 1295 work products or service, please contact them directly and verify their companies info carefully.

Total 3040 products from does cjc 1295 work Manufactures & Suppliers
Quality CJC-1295 DAC Human Growth Hormone Peptide Polypeptide For Protein Growth / Muscle Building wholesale

Brand Name:LSW

Model Number:CJC-1295 with DAC

Place of Origin:China

...CJC-1295 with DAC Human Growth Hormone Polypeptide 2mg/vial for Protein Growth and Muscle Building CJC Peptide Profile: CJC-1295 is basically a peptide hormone that acts similar to growth hormone releasing hormones (GHRH). Invented...

Wuhan Lianshangwang Technology Co.,Ltd
Verified Supplier

Hubei

Quality CJC-1295 Growth Hormone Peptides DAC MOD GRF 1-29 Increasing Growth Hormone wholesale

Brand Name:MOD GRF 1-29

Model Number:MOD GRF 1-29

Place of Origin:China

... Hormone Quick details: Product name: CJC-1295 without DAC Alias: MOD GRF 1-29 CAS NO.: 863288-34-0 Assay: 99%min Appearance: White powder Grade: Pharmaceutical Grade CJC-1295 main details CJC-1295 is basically a peptide hormone...

Shenzhen Sendi Biotechnology Co.Ltd.
Verified Supplier

Guangdong

Quality High Quality Human Peptides 51753-57-2 2mg/Vial Cjc-1295 with Dac for Weight Loss wholesale

Brand Name:HongKong Blue

Model Number:Cjc-1295 with DAC

Place of Origin:CHINA

...: Vial Origin: China Delivery Time: 4-6 Working Days State: Solid Export Markets: USA. Brazil, Australia, Canada Suitable for: Elderly, Adult Usage: Fat Loss Specification: 2mg, 5mg Description The DAC technology in the CJC-1295

HongKong Blue Universal Co., Limited.
Verified Supplier

Hongkong

Quality Peptide Hormones Bodybuilding GHRH CJC-1295 with DAC For Increases Protein Synthesis wholesale

Brand Name:wumeitech

Model Number:863288-34-0

Place of Origin:China

.../vial Cjc-1295 with Dac for Fat Burning 2mg/Vial Legal Safe Peptide CJC-1295 Acetate with Dac Muscle Growth Polypeptide Materials Human Growth Hormone Peptide Manufacturer Supply Cjc-1295 Without Dac with Over 98% Purity CJC-1295...

Zhuhai Wumei Technology Co.,ltd.
Verified Supplier

Guangdong

Quality 10mg/Vial CJC-1295 Polypeptide Hormones For Muscle Building CAS 863288-34-0 wholesale

Brand Name:YUANHANG

Model Number:863288-34-0

Place of Origin:CHINA

... Weight Loss Muscle Building What is CJC 1295? CJC-1295 is a hormone growth product. It is classified under the peptide category. Your aim is to build your body with CJC-1295. How it assists you to...

Yuanhang Bio-pharmaceutical Technology Co.,Ltd
Verified Supplier

Guangdong

Quality CAS 863288-34-0 Human Growth Hormone Peptide with DAC 2mg CJC-1295 DAC wholesale

Brand Name:Pharmlab

Model Number:863288-34-0

Place of Origin:China

...99% Human Growth Peptide CJC-1295 with DAC 2mg CAS 863288-34-0 for Muscle Growth CJC-1295 DAC Quick detail Product Name CJC-1295 With DAC CAS Number 863288-34-0 Molecular Formula C165H269N47O46 Molecular Weight 873...

Pharmlab Co.,Ltd
Verified Supplier

Hubei

Quality CAS 863288-34-0 Peptides Steroids Powder Cjc-1295 No Dac for Muscle Enhance wholesale

Brand Name:HKYC

Model Number:PEPTIDE POWDER

Place of Origin:HUBEI,CHINA

...CJC1295 Human Growth Peptide Steroid Cjc-1295 No Dac for Muscle Enhance CJC 1295 No DAC Basic Info Name CJC 1295 Alias CJC-1295 No DAC, CJC-1295 without DAC,Mod GRF 1-29 CAS 863288-34-0 M. F C152H252N44O42 M. W 3367.2 Purity (HPLC...

Hongkong YuanCheng GongChuang Technology Co.,Ltd
Verified Supplier

Quality Muscle Building Protein Peptide Hormones Lyophilized Powder Cjc-1295 Dac with GMP wholesale

Brand Name:Muscle Man

Model Number:863288-34-0

Place of Origin:Hunan,China

... Hormones Lyophilized Powder Cjc-1295 Dac with GMP For Muscle Building Product Quick Detail: Product Name CJC1295 with DAC Unit Size 2mg per vial CAS No. 863288-34-0 Synomyms CJC-1295 DAC, CJC 1295 with DAC...

Zhuzhou Interial Biotechnology Co., Ltd
Verified Supplier

Hunan

Quality Effective CJC 1295 without DAC Growth Hormones Peptide supplements Lyophilized Powder for increasing muscle mass wholesale

Brand Name:LSW

Model Number:CJC 1295 Lyophilized Powder In Vials / Pure Raw Powder No Vial

Place of Origin:China

...99% purity CJC 1295 no DAC Growth Hormones Peptide Modified GRF 1-29 CJC1295 W / O DAC 2mg / Vial Product Name CJC 1295 Also known as CJC 1295 no DAC,CJC-1295 Without DAC, CJC no DAC, Modified GRF 1-29, Mod GRF...

Wuhan Lianshangwang Technology Co.,LTD
Verified Supplier

Hubei

Quality Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial wholesale

Brand Name:Shuangbojie

Model Number:863288-34-0

Place of Origin:China

...Growth Hormone Muscle Building Peptides CJC 1295 with Dac 2mgvial 1. CJC 1295 DOSES Modified GRF 1-29(cjc1295 w/o DAC): Dose per injection: 100mcg Injections per vial: 20 x 100mcg ...

Zhuhaishi Shuangbojie Technology Co., Ltd
Verified Supplier

Guangdong

Quality CJC-1295 DAC Bodybuilding Supplements Increase GHRP Production Injection wholesale

Brand Name:Grand Uni or OEM

Model Number:CAS:863288-34-0

Place of Origin:China

...-Ile-Leu-Ser-Arg-LysLys(Maleimidopropionyl)-NH2 (Drug Affinity Complex) CJC-1295 Molecular formula: C165H269N47O46 CJC-1295 Molar Mass: 3647.15 CJC-1295 CAS number: 863288-34-0 CJC-1295 is an injectable peptide used to increase GH production.

GRAND UNIVERSE INDUSTRIAL LIMITED
Verified Supplier

Guangdong

Quality CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 wholesale

Brand Name:YIHAN

Model Number:CJC -1295

Place of Origin:China

...CJC 1295 Nutrition Fitness Peptide Growth Hormone 2mg / Vial CAS 863288-34-0 CJC-1295 Alias: CJC-1295 Acetate; CJC1295(Without DAC); Sequence: Tyr-D-Ala-Asp-Ala-Ile-Phe-Thr-Gln-Ser-Tyr-...

Yihan Industrial Co.,Ltd.
Verified Supplier

Hongkong

Quality Pure CJC-1295 Without DAC 2mg Growth Hormone Releasing Peptide Fat Loss wholesale

Brand Name:Blue Dragon

Model Number:CJC-1295 (Without/ No DAC) 2mg

Place of Origin:China Manufacturer

...CJC-1295 (Without/ No DAC) Profile: Product Name: CJC-1295 Without DAC Specification: 2mg per vial Synonyms: CJC-1295 Acetate; CJC-1295; CJC-1295 No DAC, CJC-1295 W/O DAC, Modified GRF (1-29) CAS No.: 863288-34-0 MF: C152H252N44O42 MW: 3367.97 Sequence...

Zhuhaishi Shuangbojie Technology Co., Ltd.
Verified Supplier

Guangdong

Quality CJC-1295 Without DAC 863288-34-0 Releasing Hormones (GHRH) purity 98% wholesale

Brand Name:ChineseHormone

Model Number:863288-34-0

Place of Origin:China

...CJC-1295 Without DAC Cas No.: 863288-34-0 Releasing Hormones (GHRH) 98% CJC-1295 DAC and CJC-1295 (also known as Modified GRF 1-29) are both Releasing Hormones (GHRH). Their action in the ...

Hengyang Desen Biotechnology Co., Ltd.
Verified Supplier

Hunan

Quality Human Growth Peptides CJC-1295 Acetate cjc1295 DAC 2mg/vial,863288-34-0 wholesale

Brand Name:YC

Model Number:863288-34-0

Place of Origin:China

... name: CJC-1295 Acetate Alias:GHRH, Growth Hormone Releasing Hormones,MOD GRF 1-29 CAS Registry Number: 863288-34-0 Appearance: White Powder Purity:98% Grade: Pharmaceutical Grade Storage: Shading, confined preservation CJC-1295 Effect CJC-1295 is...

Hangzhou Fuluo Biological Technology Co.,Ltd.
Verified Supplier

Zhejiang

Quality 2mg CJC 1295 without DAC CAS 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder wholesale

Brand Name:Zhenxiang

Model Number:CAS: 863288-34-0

Place of Origin:CHINA

...2mg CJC 1295 without DAC CAS: 863288-34-0 Peptide Steroid Hormones CJC 1295 White Powder Quick Detail; Product name: CJC 1295 without DAC/ CJC 1295 DAC CAS: 863288-34-0 Formula: C152H252N44O42 Molecular weight: 3367.2 purity: > 98.0% Appearance: White...

Changsha Zhenxiang Biotechnology Co., Ltd.
Verified Supplier

Hunan

Quality Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC wholesale

Brand Name:Shanghai Stero

Model Number:CJC 1295 DAC

Place of Origin:China

...Bodybuilding Hormone Supplements Growth Hormone Peptides Injection CJC 1295 DAC Description: CJC-1295 with DAC is a peptide known to help in promoting muscle gain, muscle strength, lean body ...

Shanghai Stero R&D Co,. Ltd
Verified Supplier

Shanghai

Quality CJC 1295 DAC Human Growth White Peptide Powder 2mg CJC1295 With DAC wholesale

Brand Name:JNJG

Model Number:CJC-1295 with DAC

Place of Origin:CHINA

...CJC 1295 DAC Human Growth White Peptide Powder 2mg CJC1295 With DAC Quick Detail: other name CJC1295dac, CJC1295withDAC Product Description CJC-1295 2mg/Vial Standard Medicine Grade MF C165H271N47O46 Molecular Weight 3649.30 Purity...

Jinan  Jia  Ge  Biological  Technology  Co., Ltd.
Verified Supplier

Shandong

Quality CAS 863288-34-0 CJC-1295 Body Building Peptides for Increase GH Production wholesale

Brand Name:NJBN STEROID

Model Number:863288-34-0

Place of Origin:MADE IN CHINA

...Hot Sell Body Building Peptides CAS 863288-34-0 CJC-1295 for Increase GH Production Quick Detail: Product Name CJC1295 Synonyms CJC1295;Y(d -A)DAIFTQSYRKVLAQLSARKLLQDILSR-NH2;L-Tyrosyl-D-alanyl-L-...

Nanjing Bangnuo Biotechnology Co., Ltd
Verified Supplier

Jiangsu

Quality Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass wholesale

Brand Name:Latterson

Model Number:2922199090

Place of Origin:China

...Top Quality CJC-1295 With Dac Fat Loss Growth Hormone safe pass Basic Info Product name CJC-1295 with DAC CAS register number 863288-34-0 Molecular formula C165H271N47O46 Molecular weight 3649.30 Assay ...

Zhongshan Latterson Biotechnology Co., Ltd.
Active Member

Inquiry Cart 0
  • Haven't found right suppliers
  • Our buyer assistants can help you find the most suitable, 100% reliable suppliers from China.
  • And this service is free of charge.
  • we have buyer assistants who speak English, French, Spanish......and we are ready to help you anytime!
  • Submit Buying Request